PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00097_0190
Common NameKFL_000970190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 905aa    MW: 97474.3 Da    PI: 6.4295
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00097_0190genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.1e-152069148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     rg+W ++Edellv++v+++G g+W+++ ++    ++R++k+c++r++++l
    kfl00097_0190 20 RGPWAEWEDELLVKYVAKYGEGNWASVKEKPDigLKRCGKSCRLRFLNHL 69
                     89*****************************9****************96 PP

2Myb_DNA-binding391.8e-1275117145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g+++++E++l+  +++ +G++ W++Ia +++ gRt++++k++++
    kfl00097_0190  75 KGAFSEDEEDLIFTLHTYYGNK-WSRIALELP-GRTDNEIKNFYH 117
                      799*******************.*********.**********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1851573IPR017930Myb domain
SuperFamilySSF466893.01E-2517116IPR009057Homeodomain-like
SMARTSM007176.1E-121971IPR001005SANT/Myb domain
PfamPF002491.8E-132069IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-182177IPR009057Homeodomain-like
CDDcd001672.35E-92269No hitNo description
SMARTSM007171.8E-1174122IPR001005SANT/Myb domain
PROSITE profilePS5129414.28674124IPR017930Myb domain
PfamPF002491.3E-1075117IPR001005SANT/Myb domain
CDDcd001672.60E-877117No hitNo description
Gene3DG3DSA:1.10.10.601.6E-1878122IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 905 aa     Download sequence    Send to blast
MQFPPRMEEI APTGDDGLHR GPWAEWEDEL LVKYVAKYGE GNWASVKEKP DIGLKRCGKS  60
CRLRFLNHLK PGLKKGAFSE DEEDLIFTLH TYYGNKWSRI ALELPGRTDN EIKNFYHYKC  120
KKLENARLSV PGQSAQDKVR AHEFVHSRMS TEELSINLAP REPPPASLLG KRDRADTPDR  180
DVKFQKTDSA RPVPMPPLPP QQGNSNITLR VPIIGPSKPL QLGDHPPIEK PLPVQRITSN  240
KNLESAGKLA QTAIDAARAS ASAGGRVDEA ALMAAAALHR NSTMDTKPSD AVTNMMTGVA  300
RLAAEAVLPR ASSTGFDLGG GGGQFPLQLP AGYLQQQQRL ELLSQLYNTS EQQGMKVQQQ  360
VAALFPASPV SILDVAQLDQ HQRQLLETRV RALLAARRGG DVLNRQASEP ARLDLLRRAM  420
EIEAAGRGAI GAARPVDQVE QTLERAEAFL RPKQELGAGG VGAPEHGLDR QEEMRPGGWS  480
DEPLRQGGAG PMAEVGPRAK SSEIAPSQTT EGASPLSHIE SVEKEAANPK GREDGGSIGS  540
EEVRAQDSSG SLLGPKMKAF KELRRPQLDI LGQGEDPEPG PLTAAVGRHI SPSESTARTP  600
AWLWSPRLSA GRKKWAGPIW KTVNGHSVDI SELSPDYVSE LWGLDAETFA CKTPTLSLFP  660
GAVSDDEAFS LTDRGPSTAR SPSTSDGPPW LPWLPLDGKV VTRDEVSGKL VSPRTVMEAI  720
ESGPLSPWSP RDLLESPSDG QLTSLGSSRG SGRAHQWWLS LIGTPREQPA EEKQDRAGPG  780
GGFREGPASE AAQGQEGGVK SGGLVREASL RIEGKVGESK EGGLVAEGTW PSLEDKRRPT  840
SSFTFATFAS QGDQTGAGDD QRKDETPAES APESGLRGGS PKSASMLEQV RSLFTRPSGP  900
RLDSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-20181225106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00279DAPTransfer from AT2G26960Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0U9HLW90.0A0A0U9HLW9_KLEFL; MYB domain protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.11e-38myb domain protein 81
Publications ? help Back to Top
  1. Hori K, et al.
    Klebsormidium flaccidum genome reveals primary factors for plant terrestrial adaptation.
    Nat Commun, 2014. 5: p. 3978
    [PMID:24865297]